IQCH monoclonal antibody (M04), clone 4H3
  • IQCH monoclonal antibody (M04), clone 4H3

IQCH monoclonal antibody (M04), clone 4H3

Ref: AB-H00064799-M04
IQCH monoclonal antibody (M04), clone 4H3

Información del producto

IQCH monoclonal antibody (M04), clone 4H3
Información adicional
Size 100 ug
Gene Name IQCH
Gene Alias DKFZp434F2114|FLJ12476|NYDSP5
Gene Description IQ motif containing H
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq LSQLITDHLQIQRWLFKMDSEFRGNGTAFCDIPSYLKCYKWVLKESSRYGLEDWRKKWAQEPALVKISEELAGILAQHAQPVNEKRFPTWRKFLQTFLSQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IQCH (NP_073621, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64799
Clone Number 4H3
Iso type IgG2a Kappa

Enviar uma mensagem


IQCH monoclonal antibody (M04), clone 4H3

IQCH monoclonal antibody (M04), clone 4H3