EPS8L2 monoclonal antibody (M01), clone 6C2
  • EPS8L2 monoclonal antibody (M01), clone 6C2

EPS8L2 monoclonal antibody (M01), clone 6C2

Ref: AB-H00064787-M01
EPS8L2 monoclonal antibody (M01), clone 6C2

Información del producto

EPS8L2 monoclonal antibody (M01), clone 6C2
Información adicional
Size 100 ug
Gene Name EPS8L2
Gene Alias EPS8R2|FLJ16738|FLJ21935|FLJ22171|MGC126530|MGC3088
Gene Description EPS8-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ERSQPVSQPLTYESGPDEVRAWLEAKAFSPRIVENLGILTGPQLFSLNKEELKKVCGEEGVRVYSQLTMQKAFLEKQQSGSELEELMNKFHSMNQRRGED
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EPS8L2 (NP_073609, 615 a.a. ~ 714 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64787
Clone Number 6C2
Iso type IgG1 Kappa

Enviar uma mensagem


EPS8L2 monoclonal antibody (M01), clone 6C2

EPS8L2 monoclonal antibody (M01), clone 6C2