ATPAF1 polyclonal antibody (A01)
  • ATPAF1 polyclonal antibody (A01)

ATPAF1 polyclonal antibody (A01)

Ref: AB-H00064756-A01
ATPAF1 polyclonal antibody (A01)

Información del producto

ATPAF1 polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name ATPAF1
Gene Alias ATP11|ATP11p|FLJ22351|MGC88060
Gene Description ATP synthase mitochondrial F1 complex assembly factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LHFTALINIQTRGEAAASQLILYHYPELKEEKGIVLMTAEMDSTFLNVAEAQCIANQVQLFYATDRKETYGLVETFNLRPNEFKYMSVIAELEQSGLGAELKCAQNQNKT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ATPAF1 (NP_073582, 219 a.a. ~ 328 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 64756

Enviar uma mensagem


ATPAF1 polyclonal antibody (A01)

ATPAF1 polyclonal antibody (A01)