Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ACBD3 monoclonal antibody (M01), clone 5F12
Abnova
ACBD3 monoclonal antibody (M01), clone 5F12
Ref: AB-H00064746-M03
ACBD3 monoclonal antibody (M01), clone 5F12
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ACBD3.
Información adicional
Size
100 ug
Gene Name
ACBD3
Gene Alias
GCP60|GOCAP1|GOLPH1|PAP7
Gene Description
acyl-Coenzyme A binding domain containing 3
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ACBD3 (NP_073572, 73 a.a. ~ 171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
64746
Clone Number
5F12
Iso type
IgG2a Kappa
Enviar uma mensagem
ACBD3 monoclonal antibody (M01), clone 5F12
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*