ACBD3 purified MaxPab rabbit polyclonal antibody (D01P)
  • ACBD3 purified MaxPab rabbit polyclonal antibody (D01P)

ACBD3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00064746-D01P
ACBD3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ACBD3 protein.
Información adicional
Size 100 ug
Gene Name ACBD3
Gene Alias GCP60|GOCAP1|GOLPH1|PAP7
Gene Description acyl-Coenzyme A binding domain containing 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAVLNAERLEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGRGPGASGEQPEPGEAAAGGAAEEARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHLFSTYVASHKIEKEEQEKKRKEEEERRRREEEERERLQKEEEKRRREEEERLRREEEERRRIEEERLRLEQQKQQIMAALNSQTA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ACBD3 (AAH60792.1, 1 a.a. ~ 528 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64746

Enviar uma mensagem


ACBD3 purified MaxPab rabbit polyclonal antibody (D01P)

ACBD3 purified MaxPab rabbit polyclonal antibody (D01P)