MOSPD3 monoclonal antibody (M05), clone 1H6
  • MOSPD3 monoclonal antibody (M05), clone 1H6

MOSPD3 monoclonal antibody (M05), clone 1H6

Ref: AB-H00064598-M05
MOSPD3 monoclonal antibody (M05), clone 1H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MOSPD3.
Información adicional
Size 100 ug
Gene Name MOSPD3
Gene Alias CDS3
Gene Description motile sperm domain containing 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq FRADQRSGPRQLLTLYNPTGTALRFRVLCTAPAKYTVFDAEGYVKPQSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDITSILRAPAYP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MOSPD3 (NP_076438, 43 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64598
Clone Number 1H6
Iso type IgG2a Kappa

Enviar uma mensagem


MOSPD3 monoclonal antibody (M05), clone 1H6

MOSPD3 monoclonal antibody (M05), clone 1H6