MOSPD3 MaxPab mouse polyclonal antibody (B01P)
  • MOSPD3 MaxPab mouse polyclonal antibody (B01P)

MOSPD3 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00064598-B01P
MOSPD3 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MOSPD3 protein.
Información adicional
Size 50 ug
Gene Name MOSPD3
Gene Alias CDS3
Gene Description motile sperm domain containing 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRRGAPQDQELVGPGPPGRGSRGAPPPLGPVVPVLVFPPDLVFRADQRSGPRQLLTLYNPTGTALRFRVLCTAPAKYTVFDAEGYVKPQSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDITSILRAPAYPLELQGQPDPAPRPGPPAGTPPPTARHFQEHPRQQLATSSFLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTMVFLRT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MOSPD3 (NP_076438.1, 1 a.a. ~ 235 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64598

Enviar uma mensagem


MOSPD3 MaxPab mouse polyclonal antibody (B01P)

MOSPD3 MaxPab mouse polyclonal antibody (B01P)