NDST4 purified MaxPab rabbit polyclonal antibody (D01P)
  • NDST4 purified MaxPab rabbit polyclonal antibody (D01P)

NDST4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00064579-D01P
NDST4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NDST4 protein.
Información adicional
Size 100 ug
Gene Name NDST4
Gene Alias -
Gene Description N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MNLIVKLRRSFRTLIVLLATFCLVSIVISAYFLYSGYKQEMTLIETTAEAECTDIKILPYRSMELKTVKPIDTSKTDPTVLLFVESQYSQLGQDIIAILESSRFQYHMVIAPGKGDIPPLTDNGKGKYTLVIYENILKYVSMDSWNRELLEKYCVEYSVSIIGFHKANENSLPSTQLKGFPLNLFNNLALKDCFVNPQSPLLHITKAPKVEKGPLPGEDWTIFQYNHSTYQPVLLTELQTEKSLSSLSSKTLFAT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NDST4 (NP_072091.1, 1 a.a. ~ 872 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64579

Enviar uma mensagem


NDST4 purified MaxPab rabbit polyclonal antibody (D01P)

NDST4 purified MaxPab rabbit polyclonal antibody (D01P)