DNAI2 purified MaxPab rabbit polyclonal antibody (D01P)
  • DNAI2 purified MaxPab rabbit polyclonal antibody (D01P)

DNAI2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00064446-D01P
DNAI2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DNAI2 protein.
Información adicional
Size 100 ug
Gene Name DNAI2
Gene Alias CILD9
Gene Description dynein, axonemal, intermediate chain 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEIVYVYVKKRSEFGKQCNFSDRQAELNIDIMPNPELAEQFVERNPVDTGIQCSISMSEHEANSERFEMETRGVNHVEGGWPKDVNPLELEQTIRFRKKVEKDENYVNAIMQLGSIMEHCIKQNNAIDIYEEYFNDEEAMEVMEEDPSAKTINVFRDPQEIKRAATHLSWHPDGNRKLAVAYSCLDFQRAPVGMSSDSYIWDLENPNKPELALKPSSPLVTLEFNPKDSHVLLGGCYNGQIACWDTRKGSLVAEL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DNAI2 (AAH39582.1, 1 a.a. ~ 593 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64446

Enviar uma mensagem


DNAI2 purified MaxPab rabbit polyclonal antibody (D01P)

DNAI2 purified MaxPab rabbit polyclonal antibody (D01P)