MRPS25 purified MaxPab mouse polyclonal antibody (B01P)
  • MRPS25 purified MaxPab mouse polyclonal antibody (B01P)

MRPS25 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00064432-B01P
MRPS25 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MRPS25 protein.
Información adicional
Size 50 ug
Gene Name MRPS25
Gene Alias DKFZp313H0817|FLJ00023|MRP-S25|RPMS25
Gene Description mitochondrial ribosomal protein S25
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPMKGRFPIRRTLQYLSQGNVVFKDSVKVMTVNYNTHGELGEGARKFVFFNIPQIQYKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKILGKNEETLREEEEEKKQLSHPANFGPRKYCLRECICEVEGQVPCPSLVPLPKEMRGKYKAALKADAQD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MRPS25 (NP_071942.1, 1 a.a. ~ 173 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64432

Enviar uma mensagem


MRPS25 purified MaxPab mouse polyclonal antibody (B01P)

MRPS25 purified MaxPab mouse polyclonal antibody (B01P)