TTC31 purified MaxPab mouse polyclonal antibody (B01P)
  • TTC31 purified MaxPab mouse polyclonal antibody (B01P)

TTC31 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00064427-B01P
TTC31 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TTC31 protein.
Información adicional
Size 50 ug
Gene Name TTC31
Gene Alias FLJ12788|FLJ33201|MGC120200
Gene Description tetratricopeptide repeat domain 31
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAPIPKTVGRIKLDCSLRPSCPLEVAAAPKLCKEFGPEDYGEEDIVDFLRRLVESDHQGLHRIHVDGSSGRLQLWHHDYLLGHLDDEGKSTGQSDRGKGAEGLGTYCGLRKSFLYPPQESEPCPQSPSASATFPSVSDSLLQVAMPQKLLVTEEEANRLAEELVAEEERMKQKAEKKRLKKKRQKERKRQERLEQYCGEPKASTTSDGDESPPSSPGNPVQGQCGEEEDSLDLSSTFVSLALRKVGDWPLSARRE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TTC31 (NP_071937.2, 1 a.a. ~ 423 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64427

Enviar uma mensagem


TTC31 purified MaxPab mouse polyclonal antibody (B01P)

TTC31 purified MaxPab mouse polyclonal antibody (B01P)