POLR1E purified MaxPab mouse polyclonal antibody (B01P)
  • POLR1E purified MaxPab mouse polyclonal antibody (B01P)

POLR1E purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00064425-B01P
POLR1E purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human POLR1E protein.
Información adicional
Size 50 ug
Gene Name POLR1E
Gene Alias FLJ13390|FLJ13970|PAF53|PRAF1|RP11-405L18.3
Gene Description polymerase (RNA) I polypeptide E, 53kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MAAEVLPSARWQYCGAPDGSQRAVLVQFSNGKLQSPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTLCRHFVGILNKTSGQMEVYDAELFNMQPLFSDVSVESELALESQTKTYREKMDSCIEAFGTTKQKRALNTRRMNRVGNESLNRAVAKAAETIIDTKGVTALVSDAIHNDLQDDSLYLPPCYDDAAKPEDVYKFEDLLSPAEYEALQSPSEAFRNVTSEEILKMIEENSHCTF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen POLR1E (NP_071935.1, 1 a.a. ~ 419 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64425

Enviar uma mensagem


POLR1E purified MaxPab mouse polyclonal antibody (B01P)

POLR1E purified MaxPab mouse polyclonal antibody (B01P)