ATG3 monoclonal antibody (M04), clone 1G3
  • ATG3 monoclonal antibody (M04), clone 1G3

ATG3 monoclonal antibody (M04), clone 1G3

Ref: AB-H00064422-M04
ATG3 monoclonal antibody (M04), clone 1G3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ATG3.
Información adicional
Size 100 ug
Gene Name ATG3
Gene Alias APG3|APG3-LIKE|APG3L|DKFZp564M1178|FLJ22125|MGC15201|PC3-96
Gene Description ATG3 autophagy related 3 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ATG3 (NP_071933, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64422
Clone Number 1G3
Iso type IgG2b Kappa

Enviar uma mensagem


ATG3 monoclonal antibody (M04), clone 1G3

ATG3 monoclonal antibody (M04), clone 1G3