RGS18 monoclonal antibody (M01A), clone 1H6
  • RGS18 monoclonal antibody (M01A), clone 1H6

RGS18 monoclonal antibody (M01A), clone 1H6

Ref: AB-H00064407-M01A
RGS18 monoclonal antibody (M01A), clone 1H6

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant RGS18.
Información adicional
Size 200 uL
Gene Name RGS18
Gene Alias RGS13
Gene Description regulator of G-protein signaling 18
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq METTLLFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHEDTRSSRSGHLAKETRVSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYEKFIQTDAPKEVNLDFHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNEFQDVQSDVAIWL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RGS18 (AAH20632, 1 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 64407
Clone Number 1H6
Iso type IgG1 Kappa

Enviar uma mensagem


RGS18 monoclonal antibody (M01A), clone 1H6

RGS18 monoclonal antibody (M01A), clone 1H6