CDH22 polyclonal antibody (A01)
  • CDH22 polyclonal antibody (A01)

CDH22 polyclonal antibody (A01)

Ref: AB-H00064405-A01
CDH22 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CDH22.
Información adicional
Size 50 uL
Gene Name CDH22
Gene Alias C20orf25|MGC39564|dJ998H6.1
Gene Description cadherin-like 22
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PPRFPQKMYQFSIQESAPIGTAVGRVKAEDSDVGENTDMTYHLKDESSSGGDVFKVTTDSDTQEAIIVVQKRLDFESQPVHTVILEALNKFVDPRFADLGTFRDQAIVRV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDH22 (NP_067071, 274 a.a. ~ 383 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 64405

Enviar uma mensagem


CDH22 polyclonal antibody (A01)

CDH22 polyclonal antibody (A01)