MPP5 monoclonal antibody (M01), clone 1D12
  • MPP5 monoclonal antibody (M01), clone 1D12

MPP5 monoclonal antibody (M01), clone 1D12

Ref: AB-H00064398-M01
MPP5 monoclonal antibody (M01), clone 1D12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MPP5.
Información adicional
Size 100 ug
Gene Name MPP5
Gene Alias FLJ12615|PALS1
Gene Description membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MPP5 (NP_071919, 79 a.a. ~ 177 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64398
Clone Number 1D12
Iso type IgG2a Kappa

Enviar uma mensagem


MPP5 monoclonal antibody (M01), clone 1D12

MPP5 monoclonal antibody (M01), clone 1D12