MPP5 purified MaxPab rabbit polyclonal antibody (D01P)
  • MPP5 purified MaxPab rabbit polyclonal antibody (D01P)

MPP5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00064398-D01P
MPP5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MPP5 protein.
Información adicional
Size 100 ug
Gene Name MPP5
Gene Alias FLJ12615|PALS1
Gene Description membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MTTSHMNGHVTEESDSEVKNVDLASPEEHQKHREMAVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHKEGQELTALLNTPHIQALLLAHDKVAEQEMQLEPITDERVYESIGQYGGETVK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MPP5 (NP_071919.2, 1 a.a. ~ 675 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64398

Enviar uma mensagem


MPP5 purified MaxPab rabbit polyclonal antibody (D01P)

MPP5 purified MaxPab rabbit polyclonal antibody (D01P)