IKZF4 purified MaxPab rabbit polyclonal antibody (D01P)
  • IKZF4 purified MaxPab rabbit polyclonal antibody (D01P)

IKZF4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00064375-D01P
IKZF4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IKZF4 protein.
Información adicional
Size 100 ug
Gene Name IKZF4
Gene Alias EOS|KIAA1782|ZNFN1A4
Gene Description IKAROS family zinc finger 4 (Eos)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDSRYLQLQLYLPSCSLLQGSGDSSLEKEFLGAPVGPSVSTPNSQHSSPSRSLSANSIKVEMYSDEESSRLLGPDERLLEKDDSVIVEDSLSEPLGYCDGSGPEPHSPGGIRLPNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHSGEKPFKCPFCNYACRRRDALTGHLRTHSVSSPTVGKPYKCNYCGRSYKQQSTLEEHKERCHNYLQSLSTEAQALAGQPGDEIRDLE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IKZF4 (ENSP00000262032, 1 a.a. ~ 544 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64375

Enviar uma mensagem


IKZF4 purified MaxPab rabbit polyclonal antibody (D01P)

IKZF4 purified MaxPab rabbit polyclonal antibody (D01P)