NXN purified MaxPab mouse polyclonal antibody (B01P)
  • NXN purified MaxPab mouse polyclonal antibody (B01P)

NXN purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00064359-B01P
NXN purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NXN protein.
Información adicional
Size 50 ug
Gene Name NXN
Gene Alias FLJ12614|NRX|TRG-4
Gene Description nucleoredoxin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MSGFLEELLGEKLVTGGGEEVDVHSLGARGISLLGLYFGCSLSAPCAQLSASLAAFYGRLRGDAAAGPGPGAGAGAAAEPEPRRRLEIVFVSSDQDQRQWQDFVRDMPWLALPYKEKHRKLKLWNKYRISNIPSLIFLDATTGKVVCRNGLLVIRDDPEGLEFPWGPKPFREVIAGPLLRNNGQSLESSSLEGSHVGVYFSAHWCPPCRSLTRVLVESYRKIKEAGQNFEIIFVSADRSEESFKQYFSEMPWLAV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NXN (NP_071908, 1 a.a. ~ 435 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64359

Enviar uma mensagem


NXN purified MaxPab mouse polyclonal antibody (B01P)

NXN purified MaxPab mouse polyclonal antibody (B01P)