NSD1 polyclonal antibody (A01)
  • NSD1 polyclonal antibody (A01)

NSD1 polyclonal antibody (A01)

Ref: AB-H00064324-A01
NSD1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NSD1.
Información adicional
Size 50 uL
Gene Name NSD1
Gene Alias ARA267|DKFZp666C163|FLJ10684|FLJ22263|FLJ44628|KMT3B|SOTOS|STO
Gene Description nuclear receptor binding SET domain protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTVSGTSQNAYGQDSPSCYIPLRRLQDLASMINVEYLNGSADGSESFQDPEKSDSRAQT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NSD1 (NP_071900, 2 a.a. ~ 109 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 64324

Enviar uma mensagem


NSD1 polyclonal antibody (A01)

NSD1 polyclonal antibody (A01)