TOR3A polyclonal antibody (A01)
  • TOR3A polyclonal antibody (A01)

TOR3A polyclonal antibody (A01)

Ref: AB-H00064222-A01
TOR3A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TOR3A.
Información adicional
Size 50 uL
Gene Name TOR3A
Gene Alias ADIR|ADIR2|FLJ22345|MGC111104
Gene Description torsin family 3, member A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TMEHLEPHLQAEIVETIDNGFGHSRLVKENLIDYFIPFLPLEYRHVRLCARDAFLSQELLYKEETLDEIAQMMVYVPKEEQLFSSQGCKSISQRINYFLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TOR3A (NP_071766, 298 a.a. ~ 397 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 64222

Enviar uma mensagem


TOR3A polyclonal antibody (A01)

TOR3A polyclonal antibody (A01)