SEMA4A polyclonal antibody (A01)
  • SEMA4A polyclonal antibody (A01)

SEMA4A polyclonal antibody (A01)

Ref: AB-H00064218-A01
SEMA4A polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SEMA4A.
Información adicional
Size 50 uL
Gene Name SEMA4A
Gene Alias CORD10|FLJ12287|RP35|SEMAB|SEMB
Gene Description sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GGGQGPMPRVRYYAGDERRALSFFHQKGLQDFDTLLLSGDGNTLYVGAREAILALDIQDPGVPRLKNMIPWPASDRKKSECAFKKKSNETQCFNFIRVLV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SEMA4A (NP_071762, 33 a.a. ~ 132 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 64218

Enviar uma mensagem


SEMA4A polyclonal antibody (A01)

SEMA4A polyclonal antibody (A01)