LHX5 monoclonal antibody (M05), clone 2B11
  • LHX5 monoclonal antibody (M05), clone 2B11

LHX5 monoclonal antibody (M05), clone 2B11

Ref: AB-H00064211-M05
LHX5 monoclonal antibody (M05), clone 2B11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LHX5.
Información adicional
Size 100 ug
Gene Name LHX5
Gene Alias MGC129689
Gene Description LIM homeobox 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA,IF
Immunogen Prot. Seq CTDRSLSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LHX5 (NP_071758, 136 a.a. ~ 235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64211
Clone Number 2B11
Iso type IgG2a Kappa

Enviar uma mensagem


LHX5 monoclonal antibody (M05), clone 2B11

LHX5 monoclonal antibody (M05), clone 2B11