LHX5 polyclonal antibody (A01)
  • LHX5 polyclonal antibody (A01)

LHX5 polyclonal antibody (A01)

Ref: AB-H00064211-A01
LHX5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LHX5.
Información adicional
Size 50 uL
Gene Name LHX5
Gene Alias MGC129689
Gene Description LIM homeobox 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq CTDRSLSPDLQDALQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LHX5 (NP_071758, 136 a.a. ~ 235 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 64211

Enviar uma mensagem


LHX5 polyclonal antibody (A01)

LHX5 polyclonal antibody (A01)