MMS19 purified MaxPab mouse polyclonal antibody (B01P)
  • MMS19 purified MaxPab mouse polyclonal antibody (B01P)

MMS19 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00064210-B01P
MMS19 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MMS19 protein.
Información adicional
Size 50 ug
Gene Name MMS19
Gene Alias FLJ34167|FLJ95146|MET18|MGC99604|MMS19L|hMMS19
Gene Description MMS19 nucleotide excision repair homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MRELLELSCCHSCPFSSTAAAKCFAGLLNKHPAGQQLDEFLQLAVDKVEAGLGSGPCRSQAFTLLLWVTKALVLRYHPLSSCLTARLMGLLSDPELGPAAADGFSLLMSDCTDVLTRAGHAEVRIMFRQRFFTDNVPALVQGFHAAPPDVKPNYLKGLSHVLNRLPKPVLLPELPTLLSLLLEALSCPDCVVQLSTLSCLQPLLLEAPQVMSLHVDTLVTKFLNLSSSPSMAVRIAALQCMHALTRLPTPVLLPY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MMS19 (AAH07298, 1 a.a. ~ 293 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64210

Enviar uma mensagem


MMS19 purified MaxPab mouse polyclonal antibody (B01P)

MMS19 purified MaxPab mouse polyclonal antibody (B01P)