OSGEPL1 MaxPab mouse polyclonal antibody (B01P)
  • OSGEPL1 MaxPab mouse polyclonal antibody (B01P)

OSGEPL1 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00064172-B01P
OSGEPL1 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human OSGEPL1 protein.
Información adicional
Size 50 ug
Gene Name OSGEPL1
Gene Alias -
Gene Description O-sialoglycoprotein endopeptidase-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLILTKTAGVFFKPSKRKVYEFLRSFNFHPGTLFLHKIVLGIETSCDDTAAAVVDETGNVLGEAIHSQTEVHLKTGGIVPPAAQQLHRENIQRIVQEALSASGVSPSDLSAIATTIKPGLALSLGVGLSFSLQLVGQLKKPFIPIHHMEAHALTIRLTNKVEFPFLVLLISGGHCLLALVQGVSDFLLLGKSLDIAPGDMLDKVARRLSLIKHPECSTMSGGKAIEHLAKQGNRFHFDIKPPLHHAKNCDFSFTG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen OSGEPL1 (NP_071748, 1 a.a. ~ 414 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64172

Enviar uma mensagem


OSGEPL1 MaxPab mouse polyclonal antibody (B01P)

OSGEPL1 MaxPab mouse polyclonal antibody (B01P)