NCAPG monoclonal antibody (M02), clone 2C5
  • NCAPG monoclonal antibody (M02), clone 2C5

NCAPG monoclonal antibody (M02), clone 2C5

Ref: AB-H00064151-M02
NCAPG monoclonal antibody (M02), clone 2C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NCAPG.
Información adicional
Size 100 ug
Gene Name NCAPG
Gene Alias CAPG|CHCG|FLJ12450|HCAP-G|MGC126525|NY-MEL-3
Gene Description non-SMC condensin I complex, subunit G
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TTFQNEDEKNKEVYMTPLRGVKATQASKSTQLKTNRGQRKVTVSARTNRRCQTAEADSESDHEVPEPESEMKMRLPRRAKTAALEKSKLNLAQFLNEDLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NCAPG (AAH00827, 336 a.a. ~ 435 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64151
Clone Number 2C5
Iso type IgG1 Kappa

Enviar uma mensagem


NCAPG monoclonal antibody (M02), clone 2C5

NCAPG monoclonal antibody (M02), clone 2C5