IFIH1 monoclonal antibody (M02), clone 3F6
  • IFIH1 monoclonal antibody (M02), clone 3F6

IFIH1 monoclonal antibody (M02), clone 3F6

Ref: AB-H00064135-M02
IFIH1 monoclonal antibody (M02), clone 3F6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IFIH1.
Información adicional
Size 100 ug
Gene Name IFIH1
Gene Alias Hlcd|IDDM19|MDA-5|MDA5|MGC133047
Gene Description interferon induced with helicase C domain 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq HVNMTPEFKELYIVRENKALQKKCADYQINGEIICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCLFSD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IFIH1 (NP_071451.2, 928 a.a. ~ 1023 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64135
Clone Number 3F6
Iso type IgG2a Kappa

Enviar uma mensagem


IFIH1 monoclonal antibody (M02), clone 3F6

IFIH1 monoclonal antibody (M02), clone 3F6