ELTD1 polyclonal antibody (A01)
  • ELTD1 polyclonal antibody (A01)

ELTD1 polyclonal antibody (A01)

Ref: AB-H00064123-A01
ELTD1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ELTD1.
Información adicional
Size 50 uL
Gene Name ELTD1
Gene Alias ETL|KPG_003
Gene Description EGF, latrophilin and seven transmembrane domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq TEFVKTVNNFVQRDTFVVWDKLSVNHRRTHLTKLMHTVEQATLRISQSFQKTTEFDTNSTDIALKVFFFDSYNMKHIHPHMNMDGDYINIFPKRKAAYDS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ELTD1 (XP_371262, 333 a.a. ~ 432 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 64123

Enviar uma mensagem


ELTD1 polyclonal antibody (A01)

ELTD1 polyclonal antibody (A01)