FN3K monoclonal antibody (M01), clone 4F2
  • FN3K monoclonal antibody (M01), clone 4F2

FN3K monoclonal antibody (M01), clone 4F2

Ref: AB-H00064122-M01
FN3K monoclonal antibody (M01), clone 4F2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FN3K.
Información adicional
Size 100 ug
Gene Name FN3K
Gene Alias -
Gene Description fructosamine 3 kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ALRSTGLVRVPRPMKVIDLPGGGAAFVMEHLKMKSLSSQASKLGEQMADLHLYNQKLREKLKEEENTVGRRGEGAEPQYVDKFGFHTVTCCGFIPQVNEWQDDWPTFFAR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FN3K (NP_071441.1, 61 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64122
Clone Number 4F2
Iso type IgG2a Kappa

Enviar uma mensagem


FN3K monoclonal antibody (M01), clone 4F2

FN3K monoclonal antibody (M01), clone 4F2