PARVG purified MaxPab mouse polyclonal antibody (B01P)
  • PARVG purified MaxPab mouse polyclonal antibody (B01P)

PARVG purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00064098-B01P
PARVG purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PARVG protein.
Información adicional
Size 50 ug
Gene Name PARVG
Gene Alias -
Gene Description parvin, gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLEEWQAKWSVESIFNKDLLSTLHLLVALAKRFQPDLSLPTNVQVEVITIESTKSGLKSEKLVEQLTEYSTDKDEPPKDVFDELFKLAPEKVNAVKEAIVNFVNQKLDRLGLSVQNLDTQFADGVILLLLIGQLEGFF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PARVG (NP_071424.1, 1 a.a. ~ 331 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 64098

Enviar uma mensagem


PARVG purified MaxPab mouse polyclonal antibody (B01P)

PARVG purified MaxPab mouse polyclonal antibody (B01P)