CDH23 polyclonal antibody (A01)
  • CDH23 polyclonal antibody (A01)

CDH23 polyclonal antibody (A01)

Ref: AB-H00064072-A01
CDH23 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CDH23.
Información adicional
Size 50 uL
Gene Name CDH23
Gene Alias DFNB12|DKFZp434P2350|FLJ00233|FLJ36499|KIAA1774|KIAA1812|MGC102761|USH1D
Gene Description cadherin-like 23
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PFFTNHFFDTYLLISEDTPVGSSVTQLLAQDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDH23 (NP_071407, 29 a.a. ~ 114 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 64072

Enviar uma mensagem


CDH23 polyclonal antibody (A01)

CDH23 polyclonal antibody (A01)