PRDM15 purified MaxPab mouse polyclonal antibody (B01P)
  • PRDM15 purified MaxPab mouse polyclonal antibody (B01P)

PRDM15 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00063977-B01P
PRDM15 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PRDM15 protein.
Información adicional
Size 50 ug
Gene Name PRDM15
Gene Alias C21orf83|PFM15|ZNF298
Gene Description PR domain containing 15
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAEDGSEEIMFIWCEDCSQYHDSECPELGPVVMVKDSFVLSRARSSLPPNLEIRRLEDGAEGVFAITQLVKRTQFGPFESRRVAKWEKESAFPLKVFQKDGHPVCFDTSNEDDCNWMMLVRPAAEAEHQNLTAYQHGSDVYFTTSRDIPPGTELRVWYAAFYAKKMDKPMLKQAGSGVHAAGTPENSAPVESEPSQWACKVCSATFLELQLLNEHLLGHLEQAKSLPPGSQSEAAAPEKEQDTPRGEPPAVPESE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PRDM15 (AAH67102.1, 1 a.a. ~ 1141 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 63977

Enviar uma mensagem


PRDM15 purified MaxPab mouse polyclonal antibody (B01P)

PRDM15 purified MaxPab mouse polyclonal antibody (B01P)