NEUROD6 monoclonal antibody (M06), clone 3B3
  • NEUROD6 monoclonal antibody (M06), clone 3B3

NEUROD6 monoclonal antibody (M06), clone 3B3

Ref: AB-H00063974-M06
NEUROD6 monoclonal antibody (M06), clone 3B3

Información del producto

Mouse monoclonal antibody raised against a full length recombinant NEUROD6.
Información adicional
Size 100 ug
Gene Name NEUROD6
Gene Alias Atoh2|MATH2|Math-2|NEX1M|bHLHa2
Gene Description neurogenic differentiation 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NEUROD6 (NP_073565.2, 191 a.a. ~ 290 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 63974
Clone Number 3B3
Iso type IgG2a Kappa

Enviar uma mensagem


NEUROD6 monoclonal antibody (M06), clone 3B3

NEUROD6 monoclonal antibody (M06), clone 3B3