NEUROG2 monoclonal antibody (M12), clone 1D2
  • NEUROG2 monoclonal antibody (M12), clone 1D2

NEUROG2 monoclonal antibody (M12), clone 1D2

Ref: AB-H00063973-M12
NEUROG2 monoclonal antibody (M12), clone 1D2

Información del producto

Mouse monoclonal antibody raised against a full length recombinant NEUROG2.
Información adicional
Size 100 ug
Gene Name NEUROG2
Gene Alias Atoh4|MGC46562|Math4A|NGN2|bHLHa8|ngn-2
Gene Description neurogenin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq CRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NEUROG2 (NP_076924, 74 a.a. ~ 175 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 63973
Clone Number 1D2
Iso type IgG2b Kappa

Enviar uma mensagem


NEUROG2 monoclonal antibody (M12), clone 1D2

NEUROG2 monoclonal antibody (M12), clone 1D2