NEUROG2 purified MaxPab mouse polyclonal antibody (B02P)
  • NEUROG2 purified MaxPab mouse polyclonal antibody (B02P)

NEUROG2 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00063973-B02P
NEUROG2 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NEUROG2 protein.
Información adicional
Size 50 ug
Gene Name NEUROG2
Gene Alias Atoh4|MGC46562|Math4A|NGN2|bHLHa8|ngn-2
Gene Description neurogenin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MFVKSETLELKEEEDVLVLLGSASPALAALTPLSSSADEEEEEEPGASGGARRQRGAEAGQGARGGVAAGAEGCRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCGGGGGGLPGALFSEAVLLSPGGASAALSSSGDSPSPASTWSCTNSPAPSSSVSSNSTSPYSCTLSPASPAGSDMDYWQPPP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NEUROG2 (NP_076924.1, 1 a.a. ~ 272 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 63973

Enviar uma mensagem


NEUROG2 purified MaxPab mouse polyclonal antibody (B02P)

NEUROG2 purified MaxPab mouse polyclonal antibody (B02P)