DMRTA1 polyclonal antibody (A01)
  • DMRTA1 polyclonal antibody (A01)

DMRTA1 polyclonal antibody (A01)

Ref: AB-H00063951-A01
DMRTA1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DMRTA1.
Información adicional
Size 50 uL
Gene Name DMRTA1
Gene Alias DMO|MGC163307|MGC163309
Gene Description DMRT-like family A1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ESGNESEWVKDLTSTKASLPTVSSRPRDPLDILTKIFPNYRRSRLEGILRFCKGDVVQAIEQVLNGKEHKPDNRNLANSEELENTAFQRA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DMRTA1 (NP_071443, 301 a.a. ~ 390 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 63951

Enviar uma mensagem


DMRTA1 polyclonal antibody (A01)

DMRTA1 polyclonal antibody (A01)