FKBPL purified MaxPab mouse polyclonal antibody (B01P)
  • FKBPL purified MaxPab mouse polyclonal antibody (B01P)

FKBPL purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00063943-B01P
FKBPL purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human FKBPL protein.
Información adicional
Size 50 ug
Gene Name FKBPL
Gene Alias DIR1|NG7|WISP39
Gene Description FK506 binding protein like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELEVSPDPASQILEHTQGAEKLVAELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKLGSCCRVLALGFPFGSGPPEGWTELTMGVGPWREETWGELIEKCLESMCQGEEAELQLPGHSGPPVRLTLASFTQGRDSWELETSEKEALAREERARGTELFRAGNPEGAARCYGRALRLLLTLPPPGPPERTVLH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FKBPL (NP_071393.2, 1 a.a. ~ 349 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 63943

Enviar uma mensagem


FKBPL purified MaxPab mouse polyclonal antibody (B01P)

FKBPL purified MaxPab mouse polyclonal antibody (B01P)