APBA2BP MaxPab mouse polyclonal antibody (B01P)
  • APBA2BP MaxPab mouse polyclonal antibody (B01P)

APBA2BP MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00063941-B01P
APBA2BP MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human APBA2BP protein.
Información adicional
Size 50 ug
Gene Name NECAB3
Gene Alias APBA2BP|EFCBP3|NIP1|STIP3|SYTIP2|XB51|dJ63M2.4|dJ63M2.5
Gene Description N-terminal EF-hand calcium binding protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVLSLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQFVTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQVNRLQELIDQLECKAPRLEPLREEDLAK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen APBA2BP (AAH47673.1, 1 a.a. ~ 362 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 63941

Enviar uma mensagem


APBA2BP MaxPab mouse polyclonal antibody (B01P)

APBA2BP MaxPab mouse polyclonal antibody (B01P)