LOC63929 MaxPab mouse polyclonal antibody (B01P)
  • LOC63929 MaxPab mouse polyclonal antibody (B01P)

LOC63929 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00063929-B01P
LOC63929 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LOC63929 protein.
Información adicional
Size 50 ug
Gene Name XPNPEP3
Gene Alias APP3
Gene Description X-prolyl aminopeptidase (aminopeptidase P) 3, putative
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MPWLLSAPKLVPAVANVRGLSGCMLCSQRRYSLQPVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQKEAQGQSGTDQTVVVLSNPTYYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSLPGKQLPSHKAILFVPRRDPSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSKNKVRGVQQLIQRLRLIKSPAEIERM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LOC63929 (NP_071381, 1 a.a. ~ 507 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 63929

Enviar uma mensagem


LOC63929 MaxPab mouse polyclonal antibody (B01P)

LOC63929 MaxPab mouse polyclonal antibody (B01P)