SH2D4A monoclonal antibody (M01), clone 3G8
  • SH2D4A monoclonal antibody (M01), clone 3G8

SH2D4A monoclonal antibody (M01), clone 3G8

Ref: AB-H00063898-M01
SH2D4A monoclonal antibody (M01), clone 3G8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SH2D4A.
Información adicional
Size 100 ug
Gene Name SH2D4A
Gene Alias FLJ20967|SH2A
Gene Description SH2 domain containing 4A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq KKANELLLSTGMPGSFLIRVSERIKGYALSYLSEDGCKHFLIDASADAYSFLGVDQLQHATLADLVEYHKEEPITSLGKELLLYPCGQQDQLPDYLELFE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SH2D4A (AAH14525, 239 a.a. ~ 338 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 63898
Clone Number 3G8
Iso type IgG2a Kappa

Enviar uma mensagem


SH2D4A monoclonal antibody (M01), clone 3G8

SH2D4A monoclonal antibody (M01), clone 3G8