UBE2O purified MaxPab rabbit polyclonal antibody (D01P)
  • UBE2O purified MaxPab rabbit polyclonal antibody (D01P)

UBE2O purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00063893-D01P
UBE2O purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human UBE2O protein.
Información adicional
Size 100 ug
Gene Name UBE2O
Gene Alias E2-230K|FLJ12878|KIAA1734
Gene Description ubiquitin-conjugating enzyme E2O
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTSADVMWQDGSVECNIRSNDLFPVHHLDNNEFCPGDFVVDKRVQSCPDPAVYGVVQSGDHIGRTCMVKWFKLRPSGDDVELIGEEEDVSVYDIADHPDFRFRTTDIVIRIGNTEDGAPHKEDEPSVGQVARVDVSSKVEVVWADNSKTIILPQHLYNIESEIEESDYDSVEGSTSGASSDEWEDDSDSWETDNGLVEDEHPKIEEPPIPPLEQPVAPEDKGVVISEEAATAAVQGAVAMAAPMAGLMEKAGKDG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UBE2O (AAH51868.2, 1 a.a. ~ 741 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 63893

Enviar uma mensagem


UBE2O purified MaxPab rabbit polyclonal antibody (D01P)

UBE2O purified MaxPab rabbit polyclonal antibody (D01P)