RNF123 polyclonal antibody (A01)
  • RNF123 polyclonal antibody (A01)

RNF123 polyclonal antibody (A01)

Ref: AB-H00063891-A01
RNF123 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RNF123.
Información adicional
Size 50 uL
Gene Name RNF123
Gene Alias DKFZp686C2222|FLJ12565|FP1477|KPC1|MGC163504
Gene Description ring finger protein 123
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ADYISADELAQVEQMLAHLTSASAQAAAASLPTSEEDLCPICYAHPISAVFQPCGHKSCKACINQHLMNNKDCFFCKTTIVSVEDWEKGANTSTTSSAA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF123 (NP_071347, 1216 a.a. ~ 1314 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 63891

Enviar uma mensagem


RNF123 polyclonal antibody (A01)

RNF123 polyclonal antibody (A01)