PKNOX2 MaxPab rabbit polyclonal antibody (D01)
  • PKNOX2 MaxPab rabbit polyclonal antibody (D01)

PKNOX2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00063876-D01
PKNOX2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PKNOX2 protein.
Información adicional
Size 100 uL
Gene Name PKNOX2
Gene Alias FLJ13074|PREP2
Gene Description PBX/knotted 1 homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MMQHASPAPALTMMATQNVPPPPYQDSPQMTATAQPPSKAQAVHISAPSAAASTPVPSAPIDPQAQLEADKRAVYRHPLFPLLTLLFEKCEQATQGSECITSASFDVDIENFVHQQEQEHKPFFSDDPELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCLKTKMHSDNLLRNDLGGPYSPNQPSINLHSQDLLQNSPNSMSGVSNNPQGIVVPASALQQGNIAMTTVNSQVVSGGALYQPVTMVTSQGQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PKNOX2 (AAH45626.3, 1 a.a. ~ 471 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 63876

Enviar uma mensagem


PKNOX2 MaxPab rabbit polyclonal antibody (D01)

PKNOX2 MaxPab rabbit polyclonal antibody (D01)