PKNOX2 polyclonal antibody (A01)
  • PKNOX2 polyclonal antibody (A01)

PKNOX2 polyclonal antibody (A01)

Ref: AB-H00063876-A01
PKNOX2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PKNOX2.
Información adicional
Size 50 uL
Gene Name PKNOX2
Gene Alias FLJ13074|PREP2
Gene Description PBX/knotted 1 homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PELDNLMVKAIQVLRIHLLELEKVNELCKDFCNRYITCFKTKMHSDNLLRNDLGGPYSPNQPSINLHSQDLLQNSPNSMSGVSNNPQGIVVPASALQQGN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PKNOX2 (NP_071345, 116 a.a. ~ 215 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 63876

Enviar uma mensagem


PKNOX2 polyclonal antibody (A01)

PKNOX2 polyclonal antibody (A01)