BCAN purified MaxPab mouse polyclonal antibody (B01P)
  • BCAN purified MaxPab mouse polyclonal antibody (B01P)

BCAN purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00063827-B01P
BCAN purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human BCAN protein.
Información adicional
Size 50 ug
Gene Name BCAN
Gene Alias BEHAB|CSPG7|MGC13038
Gene Description brevican
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAQLFLPLLAALVLAQAPAALADVLEGDSSEDRAFRVRIAGDAPLQGVLGGALTIPCHVHYLRPPPSRRAVLGSPRVKWTFLSRGREAEVLVARGVRVKVNEAYRFRVALPAYPASLTDVSLALSELRPNDSGIYRCEVQHGIDDSSDAVEVKVKGVVFLYREGSARYAFSFSGAQEACARIGAHIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQTPREACYGDMDGFPGVRNYGVVDPDDLYDVYCYAEDL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BCAN (AAH09117.1, 1 a.a. ~ 911 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 63827

Enviar uma mensagem


BCAN purified MaxPab mouse polyclonal antibody (B01P)

BCAN purified MaxPab mouse polyclonal antibody (B01P)