Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ZFAND3 monoclonal antibody (M03), clone 2D2
Abnova
ZFAND3 monoclonal antibody (M03), clone 2D2
Ref: AB-H00060685-M03
ZFAND3 monoclonal antibody (M03), clone 2D2
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ZFAND3.
Información adicional
Size
100 ug
Gene Name
ZFAND3
Gene Alias
FLJ13222|FLJ17799|TEX27
Gene Description
zinc finger, AN1-type domain 3
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,ELISA
Immunogen Prot. Seq
GDAGSERSKAPSLPPRCPCGFWGSSKTMNLCSKCFADFQKKQPDDDSAPSTSNSQSDLF
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ZFAND3 (NP_068762.1, 2 a.a. ~ 60 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
60685
Clone Number
2D2
Iso type
IgG1 Kappa
Enviar uma mensagem
ZFAND3 monoclonal antibody (M03), clone 2D2
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*