SMAP1 purified MaxPab mouse polyclonal antibody (B01P)
  • SMAP1 purified MaxPab mouse polyclonal antibody (B01P)

SMAP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00060682-B01P
SMAP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SMAP1 protein.
Información adicional
Size 50 ug
Gene Name SMAP1
Gene Alias FLJ13159|FLJ42245|SMAP-1
Gene Description small ArfGAP 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIRDKYEKKKYYDKNAIAITNKEKEKKKEEKKREKEPEKPAKPLTAEKLQKKDQQLEPKKSTSPKKAAEPTVDLLGLDGPAVAPVTNGNTTVPPLNDDLDIFGPMISNPLPATVMPPAQGTPSAPAAATLSTVTSGDL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SMAP1 (NP_068759.2, 1 a.a. ~ 440 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 60682

Enviar uma mensagem


SMAP1 purified MaxPab mouse polyclonal antibody (B01P)

SMAP1 purified MaxPab mouse polyclonal antibody (B01P)