PROK2 polyclonal antibody (A01)
  • PROK2 polyclonal antibody (A01)

PROK2 polyclonal antibody (A01)

Ref: AB-H00060675-A01
PROK2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PROK2.
Información adicional
Size 50 uL
Gene Name PROK2
Gene Alias BV8|KAL4|MIT1|PK2
Gene Description prokineticin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LTPRAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PROK2 (NP_068754, 20 a.a. ~ 108 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 60675

Enviar uma mensagem


PROK2 polyclonal antibody (A01)

PROK2 polyclonal antibody (A01)