MRPS35 purified MaxPab mouse polyclonal antibody (B01P)
  • MRPS35 purified MaxPab mouse polyclonal antibody (B01P)

MRPS35 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00060488-B01P
MRPS35 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MRPS35 protein.
Información adicional
Size 50 ug
Gene Name MRPS35
Gene Alias DKFZp762P093|HDCMD11P|MDS023|MGC104278|MRP-S28|MRPS28
Gene Description mitochondrial ribosomal protein S35
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFPIEIDCTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKTTDVLTIKTDRCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKTEADMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVKRLLNVT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MRPS35 (AAH15862, 1 a.a. ~ 227 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 60488

Enviar uma mensagem


MRPS35 purified MaxPab mouse polyclonal antibody (B01P)

MRPS35 purified MaxPab mouse polyclonal antibody (B01P)